PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021802
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 116aa    MW: 13536.2 Da    PI: 9.9
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021802genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.16.5e-323694159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                 ldDgy+WrKYGqK+vk++ +pr+YY+Ct++gC+vkk+v+r ++d+++v++tYeg H+h+
  DCAR_021802 36 LDDGYRWRKYGQKTVKNNAHPRNYYKCTYQGCSVKKQVQRLDKDETIVVTTYEGIHTHS 94
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.5E-342194IPR003657WRKY domain
SuperFamilySSF1182901.57E-292895IPR003657WRKY domain
PROSITE profilePS5081128.9433196IPR003657WRKY domain
SMARTSM007748.9E-373695IPR003657WRKY domain
PfamPF031064.0E-263793IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MGTDDRNDEV KVDAKQKNKN KKQRFAFQTK SQVDILDDGY RWRKYGQKTV KNNAHPRNYY  60
KCTYQGCSVK KQVQRLDKDE TIVVTTYEGI HTHSIQKPSD DFQNILSEMK IFPTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-282695776Probable WRKY transcription factor 4
2lex_A2e-282695776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065534.14e-53PREDICTED: probable WRKY transcription factor 45
SwissprotQ9S7638e-47WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLK4BDM22e-52K4BDM2_SOLLC; Uncharacterized protein
STRINGSolyc02g094270.1.17e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22042461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.19e-48WRKY DNA-binding protein 45